PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_15815.1_g00001.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family NAC
Protein Properties Length: 262aa    MW: 29842.4 Da    PI: 5.4728
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_15815.1_g00001.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM162.51.6e-5071311128
                      NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkat 86 
                              lp GfrFhPtdeelv++yL+++++++++++  vi+e+d+yk++Pw+Lp+++  +ekewyfFs+rd+ky++g+r+nr++ +gyWkat
  Rsa1.0_15815.1_g00001.1   7 LPEGFRFHPTDEELVKFYLCRRCASEPISA-PVIAEIDLYKFNPWELPEMALYGEKEWYFFSHRDRKYPNGSRPNRSAGTGYWKAT 91 
                              699*************************99.89***************7666789******************************* PP

                      NAM  87 gkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                              g dk++ +   ++ g+kk Lvfy g+ap+g+kt+W+mheyrl
  Rsa1.0_15815.1_g00001.1  92 GADKPIGK--PKTLGIKKALVFYAGKAPRGVKTNWIMHEYRL 131
                              ******98..778***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019413.14E-593166IPR003441NAC domain
PROSITE profilePS5100558.2167166IPR003441NAC domain
PfamPF023653.9E-268131IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 262 aa     Download sequence    Send to blast
MKAELNLPEG FRFHPTDEEL VKFYLCRRCA SEPISAPVIA EIDLYKFNPW ELPEMALYGE  60
KEWYFFSHRD RKYPNGSRPN RSAGTGYWKA TGADKPIGKP KTLGIKKALV FYAGKAPRGV  120
KTNWIMHEYR LANVDRSASS SNKEEQLEGT YSLRLDDWVL CRIYNKKGTM EKCYPADEVT  180
TTSTSESKCS SHVVSPGVTC SDNVESKWVD DLEDAFVFGS IESLRNDAFV PRFPYQSDDF  240
AASFEDPPEQ KPFSDWSFAT QG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A1e-80217210174Stress-induced transcription factor NAC1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006394242.11e-158hypothetical protein EUTSA_v10004786mg
RefseqXP_013630002.11e-158PREDICTED: NAC domain-containing protein 102
RefseqXP_013643322.11e-158PREDICTED: NAC domain-containing protein 102-like
RefseqXP_013735249.11e-158PREDICTED: NAC domain-containing protein 102-like
SwissprotQ8H1151e-150NA102_ARATH; NAC domain-containing protein 102
TrEMBLA0A078DAS81e-158A0A078DAS8_BRANA; BnaC03g50570D protein
TrEMBLV4KVX91e-158V4KVX9_EUTSA; Uncharacterized protein
STRINGAl_scaffold_0008_29131e-150(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM19028276
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G63790.11e-139NAC domain containing protein 102